General Information

  • ID:  hor003110
  • Uniprot ID:  A0A3S8RK80
  • Protein name:  sNPF5–12
  • Gene name:  NA
  • Organism:  Nezara viridula (Southern green stink bug) (Cimex viridulus)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nezara (genus), Pentatominae (subfamily), Pentatomidae (family), Pentatomoidea (superfamily), Pentatomomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SPQLRLRF
  • Length:  8
  • Propeptide:  MKFALPVMGFFVMVLLPAISSAPASPDYESVRELYEVLMGRDPQAADLWAGHRLVRKNSNRSPQLRLRFGRRSDPAFMQLGDHGMEHNMFDSLDN
  • Signal peptide:  MKFALPVMGFFVMVLLPAISSAPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3S8RK80-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003110_AF2.pdbhor003110_ESM.pdb

Physical Information

Mass: 114124 Formula: C46H77N15O11
Absent amino acids: ACDEGHIKMNTVWY Common amino acids: LR
pI: 12.5 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -56.25 Boman Index: -2596
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.5
Instability Index: 13590 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18201800
  • Title:  Comparative Peptidomics of Four Related Hemipteran Species: Pyrokinins, Myosuppressin, Corazonin, Adipokinetic Hormone, sNPF, and Periviscerokinins